Gold Member Since 2016
Wuhan Hengwo Scien-Tech Co., Ltd.

Sermorelin, Chemical Raw Material, Steroid Hormone manufacturer / supplier in China, offering Acetate for Body Building CAS No 86168-78-7 Sermorelin, Oral Tren Prohormone Powders Trendione Trenavar, Female Hormone Estrogen Steroids Estradiol and so on.

(/ )

Supplier Homepage Product Pharmaceutical APIs Acetate for Body Building CAS No 86168-78-7 Sermorelin

Acetate for Body Building CAS No 86168-78-7 Sermorelin

Purchase Qty.:
(g)
10-99 100+
FOB Unit Price: US $1 US $0.78
Purchase Qty. (g) FOB Unit Price
10-99 US $1
100+ US $0.78
Get Latest Price
Port: Hong Kong, Hong Kong
Production Capacity: 2000 Tons/Year
Payment Terms: T/T, Western Union, Money Gram, Bitcoin

Request a custom order and have something just for you!

Send Customized Request
Basic Info
  • Model NO.: Sermorelin
  • Customized: Customized
  • Suitable for: Adult
  • Purity: >99%
  • Alias: Sermorelin
  • Einecs No: C149h246n44o42s
  • Molecular Weight: 3357.88
  • Trademark: YC
  • Specification: USD Standard
  • HS Code: 3001200010
  • Powder: Yes
  • Certification: GMP, HSE, ISO 9001
  • State: Solid
  • Product Name: Sermorelin
  • CAS Registry Number: 86168-78-7
  • Molecular Formula: C149h246n44o42s
  • Appearance: White Powder
  • Transport Package: 1 Kg/Foil Bag
  • Origin: Hubei, China
Product Description
 Acetate for Body Building CAS No  86168-78-7 Sermorelin
Product Name:    Sermorelin
Synonyms:    SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS:    86168-78-7
MF:    C149H246N44O42S
MW:    3357.88
EINECS:    
Product Categories:    Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Mol File:    86168-78-7.mol
Sermorelin Structure
Use for treatment of short stature, and promote the growth of children


Company Profile

Wuhan Hengwo Scien-Tech Co., Ltd,is a leading supplier of raw steroids in China.We specialize in producing and seliing various kinds of
Raw steroid powders,semi-finished liquid injectable/oral steroids,polypeptide and natural hormones,Cortiscosteroids,progestational
hormones,etc.With High quality raw materials and advanced clean workshop,as well as strict quality control,our steroid hormones got many good feedback from all over the world.


Technique support is available whenever you have questions in making the steroid powders into finished products or when using.With over 14 years'
experiences exporting steroids worldwide,we have a high customs pass rate,also packages will be free resent to you in case it get seized."Delivery
guarantee,Quality service"is our promisr for you!

Let's join hand,go further and win together!
Send your message to this supplier
Avatar
Mr. Gene
Sales Manager
*From:
To: Mr. Gene
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

Find Similar Products By Category